PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_013670-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family CPP
Protein Properties Length: 596aa    MW: 64207.6 Da    PI: 7.732
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_013670-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR41.62.5e-13113152242
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                      ++k CnCk+s+Clk+YCeCfa+g++C+  C+C++C+N+ e+
  AHYPO_013670-RA 113 RQKLCNCKHSRCLKLYCECFASGVYCDG-CNCNNCCNNVEN 152
                      6899************************.********9875 PP

2TCR51.12.7e-16196234139
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                      k++kgC+Ckks ClkkYCeCf+a+  Cs++CkC dCkN 
  AHYPO_013670-RA 196 KHNKGCHCKKSGCLKKYCECFQANILCSDNCKCIDCKNF 234
                      589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.2E-12112152IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.774113236IPR005172CRC domain
PfamPF036389.7E-10115149IPR005172CRC domain
SMARTSM011146.0E-20196237IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.8E-13199234IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MEEREKGENS PPKSTMATDF PAKKLARQLD FTSVSGVSHP ASSSTSGAQP SSTSAVQQLP  60
PQPSSQPQSV MMGSLQQPAA QAPCLLPMRV AKPESPKTRS RPNIEVKDST PKRQKLCNCK  120
HSRCLKLYCE CFASGVYCDG CNCNNCCNNV ENEAARRDAV EATLERNPNA FRPKIANSPH  180
GNRDSREVTG DVVVAKHNKG CHCKKSGCLK KYCECFQANI LCSDNCKCID CKNFDGSEER  240
QALFHGDHAN NLTYVQQATN TALTGAIGSS GFSPAPISRK RKGQELLLAP TSKDTSLSRV  300
EKFQLANNVK SPGPSATSLG PASRAAHPVA LGASKFTYRS LLADIIQPQD VKELCSVLVV  360
LSKEAAKTIS ESNKSDEKQT QDAETSHASP NEDRFQSQDK PDVKNVPDNS SGGNQTDRTG  420
PDDFNLEGND QPKSRPLSPL TLALRCDEQD TMFMAGGSPN GLANHIHQSS HLPEQSTSEI  480
YAEQERIVLT NFRDCLNRLI TFGELKETQC SSLARSDSTS SQGLDNGTVK SRTDIRNQQE  540
DFNNGVSKPV IPAPVVAAQS KAPAMINATR TAVPTSNIVS QNPLETDNGD AKPSI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010688245.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0K9QRU40.0A0A0K9QRU4_SPIOL; Uncharacterized protein
STRINGVIT_11s0016g03680.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-175Tesmin/TSO1-like CXC domain-containing protein